DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and scro

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:101 Identity:22/101 - (21%)
Similarity:32/101 - (31%) Gaps:38/101 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RVKPDFKSELESFRTETLAKA-----------DTQEKNCLPT-----------AADVQSEKAQRS 57
            ::|.|  :.:.|....:|.||           :..||.|.|.           ..:..||.|.|.
  Fly   253 KIKVD--AAIYSTLISSLIKAGRSNEVSMILEEMSEKGCKPDTVTYNVLINGFCVENDSESANRV 315

  Fly    58 VIEGIEGFDASRLKHAETKEKNPLPDVEAIQAEKGV 93
            :.|.:              ||...|||.:.....||
  Fly   316 LDEMV--------------EKGLKPDVISYNMILGV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.