DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and B-H2

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster


Alignment Length:58 Identity:26/58 - (44%)
Similarity:39/58 - (67%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERRE 152
            |..|..||..|||.||.:::...|||.:|..:||:.|||::.:||.|:||||.:.:|:
  Fly   381 RKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 21/48 (44%)
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.