DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and HOXD1

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:140 Identity:41/140 - (29%)
Similarity:66/140 - (47%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LRASLPFHPYAH------PASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAP 88
            |:||...||.|.      |.:|....|    |||...|....::|::            :::||.
Human   167 LKASADGHPGAFQTASPAPGTYPKSVS----PASGLPAAFSTFEWMK------------VKRNAS 215

  Fly    89 AK--------RTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNR 145
            .|        .:|....|..|:.:||..||..:..:.||:.....::|:.|.|.:|:||||||||
Human   216 KKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNR 280

  Fly   146 RARERREKRE 155
            |.::::.:||
Human   281 RMKQKKRERE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 17/48 (35%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeodomain 233..286 CDD:459649 21/52 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.