DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and HOXA10

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens


Alignment Length:131 Identity:41/131 - (31%)
Similarity:63/131 - (48%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRT--PGRLPRIPFT 102
            ||.:|..::|.  ||..|.:....|..|          .|..:..:||....|  .||..|.|:|
Human   292 AHASSSAAEEL--SPAPSESSKASPEKD----------SLGNSKGENAANWLTAKSGRKKRCPYT 344

  Fly   103 PQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARER---REKREKDESCDSTF 164
            ..|...||..:..:.||:.|...:::.|:.||:.:|||||||||.:.:   ||.|.::.:.:..|
Human   345 KHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNF 409

  Fly   165 S 165
            |
Human   410 S 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 18/48 (38%)
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 15/58 (26%)
Homeodomain 337..393 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.