DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and MNX1

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens


Alignment Length:152 Identity:52/152 - (34%)
Similarity:74/152 - (48%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RASLPFHP---YA-----------HPA-SYVSKESGGSPPASAAE------AQIPVYDWLQYTRY 74
            :|:|..||   |:           ||| ||...:..|:.||..|:      ....:..||:.:..
Human   155 QAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTA 219

  Fly    75 HP--PKLPRALRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTR 137
            ..  ||:|....|.........|.||..||.|||..||:.:|.:.|||.....::|.||.||.|:
Human   220 GMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQ 284

  Fly   138 VKIWFQNRRARERREKREKDES 159
            |||||||||.:.:|.|:.|:::
Human   285 VKIWFQNRRMKWKRSKKAKEQA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 25/48 (52%)
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120
Homeodomain 242..298 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.