DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and arxa

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:59 Identity:28/59 - (47%)
Similarity:39/59 - (66%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREK 156
            |..||..||:.||.|:::::|.......:||..|:||..||::|||||||:.|  ||||
Zfish   219 RTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR--KREK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 18/45 (40%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212
Homeodomain 216..272 CDD:459649 24/54 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418
OAR 417..435 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.