DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and msx1a

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571348.1 Gene:msx1a / 30527 ZFINID:ZDB-GENE-980526-312 Length:233 Species:Danio rerio


Alignment Length:135 Identity:49/135 - (36%)
Similarity:66/135 - (48%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPFHPYAHPASYVSKESGGSPPA------SAAEAQIPV-------YDWLQYTRYHPPKLPRALRQ 85
            |||...|..|.  .:.:.|||.|      |....|:||       ..|:...|:.|.:|      
Zfish    42 LPFSVEALMAD--RRPNRGSPDADARLGFSVEVLQLPVKAESPERSTWVPRARFSPSRL------ 98

  Fly    86 NAPA----KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRR 146
            :.||    |....|.||.||:..||.|||..:::..|||..:..:.:.||.||.|:|||||||||
Zfish    99 SPPACPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRR 163

  Fly   147 ARERR 151
            |:.:|
Zfish   164 AKAKR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 22/46 (48%)
msx1aNP_571348.1 Homeobox 114..167 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.