DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and msx3

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571347.2 Gene:msx3 / 30526 ZFINID:ZDB-GENE-980526-306 Length:273 Species:Danio rerio


Alignment Length:176 Identity:54/176 - (30%)
Similarity:78/176 - (44%) Gaps:46/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSIEYIL-NRAGDRYVGTNASLGVLQRLRASLPFHPYAHPASYVSKESGGSPPASAAEAQIPVYD 67
            ||:|.:: :|...|.:.|::..|::.             |.|...:....||.|..|:.:|||..
Zfish    51 FSVESLISDRTSSRTLYTSSEAGIIS-------------PTSGADERLKLSPMALYADRKIPVES 102

  Fly    68 ----------------------WLQYTRYHPPKLPRALRQNAP-----AKRTPGRLPRIPFTPQQ 105
                                  |.|.|.|..|.     |.::|     .|....|.||.|||..|
Zfish   103 VSNLSDCKRGDMEELSDKGQSGWFQTTSYTSPP-----RHSSPPPCTLRKHKNNRKPRTPFTTSQ 162

  Fly   106 LQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            |.|||..:::..|||..:..:.::||.||.|:||||||||||:.:|
Zfish   163 LLALERKFRQKQYLSIAERAEFSNSLNLTETQVKIWFQNRRAKAKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 23/46 (50%)
msx3NP_571347.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..159 12/49 (24%)
Homeobox 154..207 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.