DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and dbx1a

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:170 Identity:49/170 - (28%)
Similarity:70/170 - (41%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GTNASLGVLQRLRASLPFHPYAHPASYVSKESGGS--P-------PASAAEAQIP-VYDWLQYTR 73
            |.:|.|....:...|.|.....||..:......||  |       ||.::...|| .:.|     
Zfish   105 GVSAILAPSPKKATSPPSVHSIHPKGFSVPYFDGSFCPFVRSSYFPAPSSVVPIPGTFSW----- 164

  Fly    74 YHPPKLPRALRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRV 138
                  |.|.|    .|...|.|.|..|:..|.:|||..:::..|:|..|..|||..|.|.:::|
Zfish   165 ------PLAAR----GKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQV 219

  Fly   139 KIWFQNRRARERREKREK---DESCDSTFSSNASSPEPEM 175
            ||||||||.:.|..|..:   ...|........::|.|::
Zfish   220 KIWFQNRRMKWRNSKERELLSSGGCREQTLPTKTNPHPDL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 20/48 (42%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.