DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Hoxc12

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001100266.1 Gene:Hoxc12 / 300262 RGDID:1310539 Length:280 Species:Rattus norvegicus


Alignment Length:111 Identity:33/111 - (29%)
Similarity:49/111 - (44%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PASYVSK-ESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIPFTPQQ 105
            |.|.||. ..||...||.|                 |..|...|         .|..|.|::..|
  Rat   185 PGSLVSPLNPGGGLSASGA-----------------PWYPIHSR---------SRKKRKPYSKLQ 223

  Fly   106 LQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            |..||..:..:.:::.:...:|:|.|.|::.:|||||||||.:::|
  Rat   224 LAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 16/48 (33%)
Hoxc12NP_001100266.1 Homeodomain 213..269 CDD:459649 20/55 (36%)

Return to query results.
Submit another query.