DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and ceh-9

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001021797.1 Gene:ceh-9 / 267057 WormBaseID:WBGene00000434 Length:147 Species:Caenorhabditis elegans


Alignment Length:70 Identity:27/70 - (38%)
Similarity:46/70 - (65%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKR 154
            ::|..:..|..|:.:|:..||..::...|||:.|.::||..|::|.|:|||||||||.:.::.:.
 Worm    66 QKTKRKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIES 130

  Fly   155 EKDES 159
            ||:.|
 Worm   131 EKERS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 19/48 (40%)
ceh-9NP_001021797.1 Homeodomain 71..127 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.