DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Vax1

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:92 Identity:33/92 - (35%)
Similarity:52/92 - (56%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LPRALRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQ 143
            ||:.|..:.| |||     |..||.:||..||..::...|:...:..:||..|.|:.|:||:|||
Mouse    91 LPKGLDLDRP-KRT-----RTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQ 149

  Fly   144 NRRARERREKREKDESCDSTFSSNASS 170
            |||.::::: :.||....|..|..|::
Mouse   150 NRRTKQKKD-QGKDSELRSVVSETAAT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 17/48 (35%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Homeodomain 101..157 CDD:459649 24/60 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.