DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Nkx1-2

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:137 Identity:45/137 - (32%)
Similarity:64/137 - (46%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYAHPASYVSKESGGSP-PASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIPF 101
            |.|...:..::|||... |||...                |..||..|:.|.:.....|..|..|
Mouse   115 PEARAVAVGTEESGAEGLPASPGS----------------PGSPRPRRRRAESSCAKPRRARTAF 163

  Fly   102 TPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESCDSTFSS 166
            |.:||.||||.::.:.|||..:...||.||.||.|:|||||||||.:.:::    :...|....:
Mouse   164 TYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ----NPGADGAVQA 224

  Fly   167 NASSPEP 173
            ...:|:|
Mouse   225 GGGAPQP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 25/48 (52%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 13/58 (22%)
Homeodomain 157..213 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 3/26 (12%)

Return to query results.
Submit another query.