DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and vab-15

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:218 Identity:58/218 - (26%)
Similarity:88/218 - (40%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSIEYILNRAGDRYVGTNASLGVLQRLRASLP---------------FHP--------------- 38
            ||:|.:|...             .|:.|..||               .||               
 Worm    14 FSVESLLETP-------------KQKCREDLPKPTPITPKTPMLIPGLHPMTPYFGAQLDPVMIY 65

  Fly    39 YAHPASYVSKESGGSPPASAAEAQIPV---YDWLQYTRYHPP-----KLPRALRQNAPAKRTPGR 95
            :|...:.:...|..|.|.|.|.:.:.:   ..||...|...|     |:...|.:....|....|
 Worm    66 FAQTGNRLPIVSSDSSPESCASSPLSMQHSLQWLSSQREDSPTSDDAKIQIGLSKCMLRKHKNNR 130

  Fly    96 LPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESC 160
            .||.||:.|||.:||..::...|||..:..:.:.||:||.|:||||||||||:.:|.:..:.|..
 Worm   131 KPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQEAEVEKV 195

  Fly   161 D----STFSSNA--SSPEPEMIV 177
            .    |.:::.|  .:|:|..|:
 Worm   196 KFAQASAYAAAAVGGAPDPSSIL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 22/46 (48%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.