Sequence 1: | NP_650921.1 | Gene: | CG15696 / 42469 | FlyBaseID: | FBgn0038833 | Length: | 179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509648.1 | Gene: | vab-15 / 181197 | WormBaseID: | WBGene00006881 | Length: | 225 | Species: | Caenorhabditis elegans |
Alignment Length: | 218 | Identity: | 58/218 - (26%) |
---|---|---|---|
Similarity: | 88/218 - (40%) | Gaps: | 57/218 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FSIEYILNRAGDRYVGTNASLGVLQRLRASLP---------------FHP--------------- 38
Fly 39 YAHPASYVSKESGGSPPASAAEAQIPV---YDWLQYTRYHPP-----KLPRALRQNAPAKRTPGR 95
Fly 96 LPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESC 160
Fly 161 D----STFSSNA--SSPEPEMIV 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15696 | NP_650921.1 | Homeobox | 97..144 | CDD:278475 | 22/46 (48%) |
vab-15 | NP_509648.1 | Homeobox | 132..185 | CDD:278475 | 27/52 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000776 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.770 |