DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Msx2

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:139 Identity:54/139 - (38%)
Similarity:69/139 - (49%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASLGVLQRLRASLPFHPY--AH-PASYVSKESGGSPPASAAEAQIPVYDWLQYT-RYHPPKLPRA 82
            ||.|.:.| ...||.|..  || |...|......|..:..:|...|   |:|.. ||.||  ||.
Mouse    70 ASAGAVLR-PLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAP---WIQEPGRYSPP--PRH 128

  Fly    83 LRQNAPA-----KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWF 142
            :   :|.     |....|.||.|||..||.|||..:::..|||..:..:.:.||.||.|:|||||
Mouse   129 M---SPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWF 190

  Fly   143 QNRRARERR 151
            |||||:.:|
Mouse   191 QNRRAKAKR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 23/46 (50%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 10/35 (29%)
Homeobox 145..198 CDD:306543 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.