DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and ceh-13

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans


Alignment Length:162 Identity:48/162 - (29%)
Similarity:76/162 - (46%) Gaps:35/162 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPFHP----YAHPASYV---------SKESGGSPPASA---AEAQIP---------VYDWLQYTR 73
            |..||    .|||::|:         :..||.|||||.   :.|::|         .|.|:...|
 Worm    35 LNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAELPTGVTASQHNTYKWMHTKR 99

  Fly    74 YHPPKLP--RALRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNT 136
            ...|..|  :.:.:|.        ..|..||..||..||..:..:.|::.....::|.:|:|...
 Worm   100 SQRPAAPKKKVIDENG--------TNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEA 156

  Fly   137 RVKIWFQNRRARERREKREKDESCDSTFSSNA 168
            :|||||||||.:|::.::||.....:|:.||:
 Worm   157 QVKIWFQNRRMKEKKREKEKAFLARNTWESNS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 16/46 (35%)
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.