DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and DLX3

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:157 Identity:45/157 - (28%)
Similarity:71/157 - (45%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PFHPYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRI 99
            |...|.:.|||  ::.|     :..|..:|..|.:. .:..|....|.:  |...|:.  |.||.
Human    82 PKSEYTYGASY--RQYG-----AYREQPLPAQDPVS-VKEEPEAEVRMV--NGKPKKV--RKPRT 134

  Fly   100 PFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRAR------------ERRE 152
            .::..||.||:..::::.||:..:..:||..|.||.|:|||||||||::            |...
Human   135 IYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSP 199

  Fly   153 KREKDESCDSTFS------SNASSPEP 173
            ......:|:|..|      |:.|:|.|
Human   200 NNSDSMACNSPPSPALWDTSSHSTPAP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 20/48 (42%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567 8/31 (26%)
COG5576 <109..232 CDD:227863 36/123 (29%)
homeobox 129..188 24/60 (40%)
Homeodomain 130..186 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.