DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and ceh-7

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_495848.1 Gene:ceh-7 / 174391 WormBaseID:WBGene00000432 Length:84 Species:Caenorhabditis elegans


Alignment Length:70 Identity:31/70 - (44%)
Similarity:40/70 - (57%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRA 147
            :|..|...|.|.|  |..||.:||..||..:.:|.|:..::..:||..|.|...:|||||||||.
 Worm    14 VRPEASTSRIPRR--RTTFTVEQLYLLEMYFAQSQYVGCDERERLARILSLDEYQVKIWFQNRRI 76

  Fly   148 RERRE 152
            |.|||
 Worm    77 RMRRE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 19/48 (40%)
ceh-7NP_495848.1 Homeodomain 25..80 CDD:459649 24/56 (43%)

Return to query results.
Submit another query.