DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Hoxa4

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:70/200 - (35%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RASLPFHP---YAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHP---PKLPRALRQNAPA 89
            ||..|.:|   |..||:.......|:.||...::..|        ..||   |:.|...|..||.
Mouse    69 RAREPSYPGGLYPAPAAACPYACRGASPARPEQSPAP--------GAHPSPAPQPPAPPRHCAPG 125

  Fly    90 KRTP-----GRLPRIP---------------------------------------------FTPQ 104
            ..||     |..|..|                                             :|.|
Mouse   126 PTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNSSYNGGEPKRSRTAYTRQ 190

  Fly   105 QLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESCDST---FSS 166
            |:..||..:..:.||:.....::|.:|.|:..:|||||||||.     |.:||....:|   .|:
Mouse   191 QVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRM-----KWKKDHKLPNTKMRSSN 250

  Fly   167 NASSP 171
            .||:|
Mouse   251 TASAP 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 17/93 (18%)