DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Hoxa13

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_032290.1 Gene:Hoxa13 / 15398 MGIID:96173 Length:386 Species:Mus musculus


Alignment Length:121 Identity:33/121 - (27%)
Similarity:59/121 - (48%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FHPYAHP-----ASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGR 95
            :.|:|.|     ..|..||.  :.|....::.:|  |.:.    ||        .:|.:.|. ||
Mouse   274 YQPWALPNGWNGQMYCPKEQ--TQPPHLWKSTLP--DVVS----HP--------SDASSYRR-GR 321

  Fly    96 LPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            ..|:|:|..||:.||..|..:.:::.:...:::.:..|:..:|.|||||||.:|::
Mouse   322 KKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 14/48 (29%)
Hoxa13NP_032290.1 HoxA13_N <151..222 CDD:463521
Homeodomain 321..377 CDD:459649 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.