DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Hhex

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:181 Identity:51/181 - (28%)
Similarity:74/181 - (40%) Gaps:56/181 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PFHP--YAHPASYVSKESGGSPPASAAEAQIPVYDWLQ----YT----RYHP--------PKLPR 81
            |.||  ..|||:.::...|.|....      |:|.:.:    ||    |:.|        |.|.|
Mouse    75 PVHPAFSHHPAAALAAAYGPSGFGG------PLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQR 133

  Fly    82 ALRQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRR 146
            .|.     ||..|   ::.|:..|...||..::...|||..:..:||..|:|:..:||.||||||
Mouse   134 PLH-----KRKGG---QVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRR 190

  Fly   147 ARERREKREK------------DESCD------------STFSSNASSPEP 173
            |:.||.|:|.            |.||:            ::...:..||.|
Mouse   191 AKWRRLKQENPQSNKKDALDSLDTSCEQGQDLPSEQNKGASLDRSQCSPSP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 15/48 (31%)
HhexNP_032271.1 Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 1..138 18/73 (25%)
Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 138..271 32/107 (30%)
Homeodomain 143..195 CDD:459649 20/51 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..271 9/47 (19%)

Return to query results.
Submit another query.