DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Dlx2

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_034184.1 Gene:Dlx2 / 13392 MGIID:94902 Length:332 Species:Mus musculus


Alignment Length:147 Identity:44/147 - (29%)
Similarity:71/147 - (48%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAP-------------A 89
            ||||..||....||.:..:.:|::...:.....||.|.|.....:...|.|             .
Mouse    86 PYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNG 150

  Fly    90 KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKR 154
            |....|.||..::..||.||:..::::.||:..:..:||.||.||.|:|||||||||::.::..:
Mouse   151 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWK 215

  Fly   155 EKDESCDSTFSSNASSP 171
            ..:...:....::||.|
Mouse   216 SGEIPTEQHPGASASPP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 20/46 (43%)
Dlx2NP_034184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..83
DLL_N 54..135 CDD:289198 13/48 (27%)
Homeobox 158..211 CDD:278475 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..272 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.