DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and VAX1

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001106175.1 Gene:VAX1 / 11023 HGNCID:12660 Length:334 Species:Homo sapiens


Alignment Length:145 Identity:43/145 - (29%)
Similarity:69/145 - (47%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PASYVSKESGGSPPASAAE---------AQIPVYDWLQYTRYHPPK-------LPRALRQNAPAK 90
            ||:::.:..|....:.|||         |..|  |:.:.......|       ||:.|..:.| |
Human    40 PAAFLKEPQGAFSASGAAEDCNKSKSNSAADP--DYCRRILVRDAKGSIREIILPKGLDLDRP-K 101

  Fly    91 RTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKRE 155
            ||     |..||.:||..||..::...|:...:..:||..|.|:.|:||:||||||.::::: :.
Human   102 RT-----RTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKD-QG 160

  Fly   156 KDESCDSTFSSNASS 170
            ||....|..|..|::
Human   161 KDSELRSVVSETAAT 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 17/48 (35%)