DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and HOXB13

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_006352.2 Gene:HOXB13 / 10481 HGNCID:5112 Length:284 Species:Homo sapiens


Alignment Length:174 Identity:40/174 - (22%)
Similarity:70/174 - (40%) Gaps:51/174 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AGDRYVGTNASLGVLQRLRASLPFHP--YAHPASYVS---KESGGSPPASAAEAQIPVYDWLQY- 71
            ||:.|.......       |..|.:|  |...|||:.   .::.|:|.....::.:||..:..: 
Human   116 AGEEYPSRPTEF-------AFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWA 173

  Fly    72 -----------------------------TRYHPPKLPRALRQNAPAKRTPGRLPRIPFTPQQLQ 107
                                         :..|||        :|.|.|. ||..|||::..||:
Human   174 LAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPP--------DACAFRR-GRKKRIPYSKGQLR 229

  Fly   108 ALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            .||..|..:.:::.:...|::.:..|:..::.|||||||.:|::
Human   230 ELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 13/46 (28%)
HOXB13NP_006352.2 HoxA13_N 12..121 CDD:372013 2/4 (50%)
HOX 216..272 CDD:197696 19/55 (35%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 217..246 9/28 (32%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 258..269 6/10 (60%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 270..273 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.