DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synd and FCHSD1

DIOPT Version :9

Sequence 1:NP_001262786.1 Gene:Synd / 42467 FlyBaseID:FBgn0053094 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_258260.1 Gene:FCHSD1 / 89848 HGNCID:25463 Length:690 Species:Homo sapiens


Alignment Length:595 Identity:110/595 - (18%)
Similarity:204/595 - (34%) Gaps:161/595 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCNDLQQLIQERADIEKGYAKSLRTWS--------KKWGELIEKGPEYGTTEAAWKGVLTESE-- 90
            |..|::...::||.||:.|.::|:..:        .:.||:..:|   .|...||:.:|..:.  
Human    35 LLEDIRSYSKQRAAIEREYGQALQKLAGPFLKREGHRSGEMDSRG---RTVFGAWRCLLDATVAG 96

  Fly    91 -----RISDVHMKIKDNLCNDVNSQIKTWQKENYH----HTLMQIKERKDLEDLFKKAQKPWAKL 146
                 :.||.:..:..........|:.....||..    ..|..::|......|:.:.::.||  
Human    97 GQTRLQASDRYRDLAGGTGRSAKEQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWA-- 159

  Fly   147 LAKVEKAKADYHSACKTERSATNQERNANADSSL--SPDQVKKMHDRVQ----KTKDQVQKCREK 205
            ||:              |::|..|.|...:|..:  |...::|:..::.    :...|:|..|.:
Human   160 LAQ--------------EKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLQAARNE 210

  Fly   206 Y-EQAIAEITKYNSVYIEDMTSVF------------EKCQTFEKTRLQFFKEILFNVH----SCL 253
            | ...:|.....:..|.|::.::.            :...:...|.|:..:.||.:.|    :..
Human   211 YLLNLVATNAHLDHYYQEELPALLKALVSELSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTS 275

  Fly   254 DLTKVQSLPQIYEE---FSHT------INNADQQKDLKWWS------------------------ 285
            .::..|.|....:|   ||.|      ....||...|:|.:                        
Human   276 QVSWEQDLKLFLQEPGVFSPTPPQQFQPAGTDQVCVLEWGAEGVAGKSGLEKEVQRLTSRAARDY 340

  Fly   286 --NNHGINMAMNW------------PSFVEYTEEFRDIAKGNKSKEALPAAPITLIN-------- 328
              .|||..:....            ||..:..:|.|:..:..:..:...||.:.|:.        
Human   341 KIQNHGHRVLQRLEQRRQQASEREAPSIEQRLQEVRESIRRAQVSQVKGAARLALLQGAGLDVER 405

  Fly   329 -QRPVAEDVHQEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQSSVTTSEAKTSAAVAGAATATA 392
             .:|.......|..|...|.:...:...:|..|. .:|::..:....|.|.....|....||...
Human   406 WLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAE-DAELSDFEECEETGELFEEPAPQALATRAL 469

  Fly   393 AATA-----ASAASNRNSSVTNGNGKVDANPFDEEEEWDESDNVLVDNGEPG-VP---------- 441
            ...|     ..|......::|.|.. ::.....:.:||.::.|   .:||.| ||          
Human   470 PCPAHVVFRYQAGREDELTITEGEW-LEVIEEGDADEWVKARN---QHGEVGFVPERYLNFPDLS 530

  Fly   442 --------------------VKALYDYEGAESDELTFKQGDVFEKL---EDEDEQGWCKGRMNGR 483
                                .:|||.|.|..::||:|.:|.:...|   :|..:.|:.:|...||
Human   531 LPESSQDSDNPCGAEPTAFLAQALYSYTGQSAEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGR 595

  Fly   484 VGLYPANYVE 493
            ||::|:..||
Human   596 VGVFPSLLVE 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyndNP_001262786.1 F-BAR_PACSIN 17..272 CDD:153339 52/286 (18%)
SH3_PACSIN 441..493 CDD:212777 19/84 (23%)
FCHSD1NP_258260.1 F-BAR_FCHSD1 16..275 CDD:153362 46/258 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..444 4/22 (18%)
SH3_FCHSD_1 470..526 CDD:212695 12/59 (20%)
SH3_FCHSD1_2 550..607 CDD:212828 20/56 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 609..690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.