Sequence 1: | NP_001262786.1 | Gene: | Synd / 42467 | FlyBaseID: | FBgn0053094 | Length: | 495 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_219497.4 | Gene: | LSB3 / 850580 | SGDID: | S000002968 | Length: | 459 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 225 | Identity: | 51/225 - (22%) |
---|---|---|---|
Similarity: | 84/225 - (37%) | Gaps: | 65/225 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 EDVHQEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQS-------------------SVTTSEAK 379
Fly 380 TSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPF--DEEEEWDE--------------- 427
Fly 428 SDNVLVD-------------------NGEPGVPVK---------ALYDYEGAESDELTFKQGDVF 464
Fly 465 EKLEDEDEQG-WCKGRMNGRVGLYPANYVE 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Synd | NP_001262786.1 | F-BAR_PACSIN | 17..272 | CDD:153339 | |
SH3_PACSIN | 441..493 | CDD:212777 | 26/61 (43%) | ||
LSB3 | NP_219497.4 | SYLF | 1..219 | CDD:225482 | |
SH3_Ysc84p_like | 404..458 | CDD:212776 | 27/54 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2056 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |