DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synd and LSB3

DIOPT Version :9

Sequence 1:NP_001262786.1 Gene:Synd / 42467 FlyBaseID:FBgn0053094 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_219497.4 Gene:LSB3 / 850580 SGDID:S000002968 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:51/225 - (22%)
Similarity:84/225 - (37%) Gaps:65/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 EDVHQEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQS-------------------SVTTSEAK 379
            :|.:.:....|.:..:.|:..:.|:|.:.:|.....||                   |..:..|.
Yeast   233 DDYYDDDDYYNDIPSSFSSTDASSTRPNTRSTRRRAQSGSRYTFDDDDDDDDYGTGYSRNSRLAP 297

  Fly   380 TSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPF--DEEEEWDE--------------- 427
            |::..:|......:..::..||:|.|.......:...|.:  ||.:::|:               
Yeast   298 TNSGGSGGKLDDPSGASSYYASHRRSGTAQSRARSSRNRWADDEYDDYDDDYESGYRRGNGRDRT 362

  Fly   428 SDNVLVD-------------------NGEPGVPVK---------ALYDYEGAESDELTFKQGDVF 464
            .|..:.|                   .|....|..         |||.:.|.||.:|.|::|||.
Yeast   363 KDREVDDLSNRFSKSRISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVI 427

  Fly   465 EKLEDEDEQG-WCKGRMNGRVGLYPANYVE 493
            ..|:..|.|. |..||:|||.|::||||||
Yeast   428 TILKKSDSQNDWWTGRVNGREGIFPANYVE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyndNP_001262786.1 F-BAR_PACSIN 17..272 CDD:153339
SH3_PACSIN 441..493 CDD:212777 26/61 (43%)
LSB3NP_219497.4 SYLF 1..219 CDD:225482
SH3_Ysc84p_like 404..458 CDD:212776 27/54 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.