DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synd and SH3YL1

DIOPT Version :9

Sequence 1:NP_001262786.1 Gene:Synd / 42467 FlyBaseID:FBgn0053094 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_056492.2 Gene:SH3YL1 / 26751 HGNCID:29546 Length:342 Species:Homo sapiens


Alignment Length:61 Identity:22/61 - (36%)
Similarity:34/61 - (55%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 VDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQ-GWCKGRMNGRVGLYPANYV 492
            |.|....:.|.|||.:||.:..:|.|:.||....:...|.. .|.:|::.|:.|::|||||
Human   279 VGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyndNP_001262786.1 F-BAR_PACSIN 17..272 CDD:153339
SH3_PACSIN 441..493 CDD:212777 20/53 (38%)
SH3YL1NP_056492.2 SYLF_SH3YL1_like 11..209 CDD:211401
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..266
SH3_SH3YL1_like 287..340 CDD:212775 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.