Sequence 1: | NP_001262786.1 | Gene: | Synd / 42467 | FlyBaseID: | FBgn0053094 | Length: | 495 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038737.1 | Gene: | Sh3yl1 / 24057 | MGIID: | 1346118 | Length: | 340 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 43/196 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 YTEEFR--DIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTLSSVSSRASVKS 364
Fly 365 EIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPFDEEEEWDESD 429
Fly 430 NVLVDNGEPGVPVKALYDYEGAESDELTFKQGD---VFEKLEDEDEQGWCKGRMNGRVGLYPANY 491
Fly 492 V 492 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Synd | NP_001262786.1 | F-BAR_PACSIN | 17..272 | CDD:153339 | |
SH3_PACSIN | 441..493 | CDD:212777 | 21/55 (38%) | ||
Sh3yl1 | NP_038737.1 | SYLF_SH3YL1_like | 11..209 | CDD:211401 | 10/47 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 226..259 | 6/34 (18%) | |||
SH3_SH3YL1_like | 285..338 | CDD:212775 | 21/55 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2056 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |