DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synd and SH3D19

DIOPT Version :9

Sequence 1:NP_001262786.1 Gene:Synd / 42467 FlyBaseID:FBgn0053094 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001365050.1 Gene:SH3D19 / 152503 HGNCID:30418 Length:1070 Species:Homo sapiens


Alignment Length:55 Identity:24/55 - (43%)
Similarity:35/55 - (63%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 GVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVE 493
            |...|||||:.|...|||:||.||:..:||..|:. |..|.:.|:.|::|.||::
Human  1012 GRKAKALYDFRGENEDELSFKAGDIITELESVDDD-WMSGELMGKSGIFPKNYIQ 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyndNP_001262786.1 F-BAR_PACSIN 17..272 CDD:153339
SH3_PACSIN 441..493 CDD:212777 23/51 (45%)
SH3D19NP_001365050.1 PHA03247 <168..649 CDD:223021
SH3_Eve1_1 699..748 CDD:212748
SH3_Eve1_2 779..830 CDD:212749
SH3_Eve1_3 855..905 CDD:212750
SH3_Eve1_4 945..994 CDD:212751
SH3_Eve1_5 1014..1063 CDD:212752 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.