DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synd and mpp7b

DIOPT Version :9

Sequence 1:NP_001262786.1 Gene:Synd / 42467 FlyBaseID:FBgn0053094 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_021324128.1 Gene:mpp7b / 101882129 ZFINID:ZDB-GENE-141212-293 Length:298 Species:Danio rerio


Alignment Length:276 Identity:56/276 - (20%)
Similarity:106/276 - (38%) Gaps:84/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 LTKVQSLP-QIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYTEEFRDIAKGNKSKEA 318
            |...|.|. ::.||...|:|:.:..:.|...|..|           |:......|:....:....
Zfish    26 LDSTQGLAHRLAEELQDTVNSPETTELLNLLSKPH-----------VQTLLLVHDVVAQKRFDPR 79

  Fly   319 LPAAPITLINQRPVAEDVHQEYPQTNSLK-----KNTSTLSSVSSRASVKSEIATTQSSVTTSEA 378
            ||  |:      |...|.::|  ..:|:|     ||...|.     |::|.:             
Zfish    80 LP--PL------PPLPDCNEE--DEDSIKIVCLVKNQEPLG-----ATIKRD------------- 116

  Fly   379 KTSAAVAGAATATAAATAASAASNRNSSVTNGN--GKVDANPFDEEEEWD------ESDNVLVDN 435
            ::|.|:      ..|......|::|:..:..|:  .:|:..|.:::...:      :|:..:...
Zfish   117 ESSGAI------IVARVMRGGAADRSGLIHEGDMLKEVNGVPVEDKNLQEIIPILAKSEGAVTFK 175

  Fly   436 GEPG-----------VPVKALYDYEGAESDE--------LTFKQGDVFEKLEDEDEQGWCKGRMN 481
            ..||           |.|:||:||: .::|.        |.|::|||.: :..:|:..|.:.|.:
Zfish   176 VVPGTNEELETNDTQVFVRALFDYD-PQADPAIPCRDAGLEFQRGDVLQ-IVSQDDDTWWQARRH 238

  Fly   482 G----RVGLYPANYVE 493
            |    |.||.|:..::
Zfish   239 GDANLRAGLIPSRQLQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyndNP_001262786.1 F-BAR_PACSIN 17..272 CDD:153339 5/17 (29%)
SH3_PACSIN 441..493 CDD:212777 19/63 (30%)
mpp7bXP_021324128.1 L27 31..74 CDD:308467 10/53 (19%)
PDZ 97..179 CDD:214570 15/105 (14%)
SH3_MPP 192..252 CDD:212796 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D727724at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.