DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CAM4

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001185330.1 Gene:CAM4 / 842959 AraportID:AT1G66410 Length:159 Species:Arabidopsis thaliana


Alignment Length:158 Identity:55/158 - (34%)
Similarity:84/158 - (53%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARSGQINNLD-----------ELTVIMRSLGLSPTIQELVSYLKQ 54
            ||....::.|.||:|.|.||.:.|..:..|           ||..:|||||.:||..||...:.:
plant     1 MADQLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQDMINE 65

  Fly    55 ----KNGKMSFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMR 115
                .||.:.|.:||::|.:..|.....:|:..||:..|....|.|||.:||:::.|.||.|:..
plant    66 VDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 130

  Fly   116 EVDNIFREANVNNNSTVRYADFVKIACA 143
            ||:.:.|||:|:.:..:.|.:||||..|
plant   131 EVEEMIREADVDGDGQINYEEFVKIMMA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 54/156 (35%)
CAM4NP_001185330.1 PTZ00184 1..159 CDD:185504 55/158 (35%)
EFh <36..84 CDD:238008 16/47 (34%)
EFh 95..157 CDD:238008 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.