DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and AT1G62820

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_176470.1 Gene:AT1G62820 / 842581 AraportID:AT1G62820 Length:148 Species:Arabidopsis thaliana


Alignment Length:132 Identity:44/132 - (33%)
Similarity:68/132 - (51%) Gaps:3/132 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IDEFRECFYLFARSGQINNL-DELTVIMRSLGLSPTIQELVSYLKQKN--GKMSFADFLDIMHQH 71
            :...:|.|.||...|..... .||.::|||||.:||..:|.|.:..:|  ....|..|||:|.:|
plant    11 VSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITTENLSSPFDFNRFLDLMAKH 75

  Fly    72 SKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYAD 136
            .|.|....::..|||..|.:..|.::...||::|.:.||.|...|.|...:|.:|.::..:||.|
plant    76 LKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSEFDEWIKEVDVGSDGKIRYED 140

  Fly   137 FV 138
            |:
plant   141 FI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 44/132 (33%)
AT1G62820NP_176470.1 PTZ00184 4..148 CDD:185504 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.