powered by:
Protein Alignment CG17272 and CML37
DIOPT Version :9
Sequence 1: | NP_650917.1 |
Gene: | CG17272 / 42465 |
FlyBaseID: | FBgn0038830 |
Length: | 149 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199053.1 |
Gene: | CML37 / 834244 |
AraportID: | AT5G42380 |
Length: | 185 |
Species: | Arabidopsis thaliana |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 35/62 - (56%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 DEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYADFVKI 140
:|:...|...|..:.|.||..:|::.:...|..||.|||:.:.:.::|:.:..:.:.:|:|:
plant 48 NELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKL 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23050 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.