DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CAM5

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_850097.1 Gene:CAM5 / 817245 AraportID:AT2G27030 Length:181 Species:Arabidopsis thaliana


Alignment Length:148 Identity:53/148 - (35%)
Similarity:81/148 - (54%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARSGQ-INNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMS 60
            ||....:..|.||:|.|.||.:.|. .....||..:|||||.:||..||...:.:    .||.:.
plant     1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

  Fly    61 FADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREAN 125
            |.:||::|.:..|.....:|:..||:..|....|.|||.:||:::.|.||.|:..|||.:.:||:
plant    66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEAD 130

  Fly   126 VNNNSTVRYADFVKIACA 143
            |:.:..:.|.:|||:..|
plant   131 VDGDGQINYEEFVKVMMA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 52/146 (36%)
CAM5NP_850097.1 PTZ00184 1..149 CDD:185504 53/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.