DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Calm4

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_064420.2 Gene:Calm4 / 80796 MGIID:1931464 Length:148 Species:Mus musculus


Alignment Length:146 Identity:43/146 - (29%)
Similarity:81/146 - (55%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARS--GQINNLDELTVIMRSLGLS---PTIQELVSYL-KQKNGKM 59
            |:..|.::::.||:..|..|.::  |.| :::||..:|:.||.:   ..::.|:|.| ...:||:
Mouse     1 MSHGFTKEEVAEFQAAFNRFDKNKDGHI-SVEELGDVMKQLGKNLPEKDLKALISKLDTDGDGKI 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            ||.:||..:.::.|... ..|:.|.|...|....|.|:..:|:..|...||.||..|::::.|.|
Mouse    65 SFEEFLTAIEKYKKGHR-AGELRAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVA 128

  Fly   125 NVNNNSTVRYADFVKI 140
            :|:.:..|:|.:||::
Mouse   129 DVDQDGKVKYEEFVRL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 43/146 (29%)
Calm4NP_064420.2 PTZ00184 1..148 CDD:185504 43/146 (29%)
EFh 12..73 CDD:238008 20/61 (33%)
EFh 84..145 CDD:238008 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.