DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CALM1

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001350599.1 Gene:CALM1 / 801 HGNCID:1442 Length:150 Species:Homo sapiens


Alignment Length:142 Identity:52/142 - (36%)
Similarity:79/142 - (55%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLFARSGQ-INNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADFLD 66
            |:.|.||:|.|.||.:.|. .....||..:|||||.:||..||...:.:    .||.:.|.:||.
Human     8 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 72

  Fly    67 IMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNST 131
            :|.:..|.....:|:..||:..|....|.|||.:||:::.|.||.|:..|||.:.|||:::.:..
Human    73 MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 137

  Fly   132 VRYADFVKIACA 143
            |.|.:||::..|
Human   138 VNYEEFVQMMTA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 51/140 (36%)
CALM1NP_001350599.1 PTZ00184 3..150 CDD:185504 52/142 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.