DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Calml4

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_612177.1 Gene:Calml4 / 75600 MGIID:1922850 Length:153 Species:Mus musculus


Alignment Length:154 Identity:61/154 - (39%)
Similarity:90/154 - (58%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARS--GQINNLDELTVIMRSLGLSPTIQELVSYLK----QKNGKM 59
            ||::..:..|:|::|||.|:.:.  |:|...| |.|.||.||.|||..|:..:|:    .|||::
Mouse     1 MAKFLSQDQINEYKECFSLYDKQQRGKIKATD-LLVSMRCLGASPTPGEVQRHLQTHGIDKNGEL 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            .|:.||.|||...|.|....|::.|...||.:.||.|.|.:||:.|...||.|:.:|||::|:||
Mouse    65 DFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHKEVDDLFKEA 129

  Fly   125 NVNNNSTVRYADFVKIACAPVPDY 148
            .:..|..|:|..|::....||.||
Mouse   130 GIEPNGQVKYDTFIQRITIPVRDY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 57/147 (39%)
Calml4NP_612177.1 PTZ00184 1..144 CDD:185504 57/143 (40%)
EFh 12..74 CDD:238008 26/62 (42%)
EFh 94..147 CDD:298682 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S993
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0006063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5380
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.