DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Calml4

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:154 Identity:60/154 - (38%)
Similarity:89/154 - (57%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARS--GQINNLDELTVIMRSLGLSPTIQELVSYLK----QKNGKM 59
            ||::..::.|:|::|||.|:.:.  |:|...| |.|.||.||.|||..|:..:|:    .|||::
  Rat     1 MAKFLSQEQINEYKECFSLYDKQQRGKIKATD-LLVSMRCLGASPTPGEVQRHLQTHGIDKNGEL 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            .|:.||.|||...|.|....|::.|....|.:.||.|.|.:||:.|...||.|:.:|||.:|:||
  Rat    65 DFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKEA 129

  Fly   125 NVNNNSTVRYADFVKIACAPVPDY 148
            .:..|..|:|..|::....||.||
  Rat   130 GIEPNGQVKYDTFIQRITLPVRDY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 56/147 (38%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 56/143 (39%)
EFh 12..74 CDD:238008 26/62 (42%)
EFh 94..147 CDD:298682 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0006063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.