DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and ocm3

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001025657.1 Gene:ocm3 / 595049 XenbaseID:XB-GENE-5833501 Length:109 Species:Xenopus tropicalis


Alignment Length:62 Identity:14/62 - (22%)
Similarity:25/62 - (40%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DEVIAAFKAADPQNKGTISARQLRNLLQNW---GEGLSMREVDNIFREANVNNNSTVRYADF 137
            |:|...|:..|....|.|...:|:..|||:   ...||..|.....:..:.:.:..:...:|
 Frog    42 DQVRKVFEILDRDKSGFIEEDELQLFLQNFKSNARALSAAETKAFLKAGDSDGDGKIGVDEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 14/62 (23%)
ocm3NP_001025657.1 EFh_parvalbumin_beta 9..109 CDD:319998 14/62 (23%)
EF-hand motif 9..38 CDD:319998
EF-hand motif 43..72 CDD:319998 9/28 (32%)
EF-hand motif 82..109 CDD:319998 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.