DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Myl1

DIOPT Version :10

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_008765516.1 Gene:Myl1 / 56781 RGDID:1598796 Length:212 Species:Rattus norvegicus


Alignment Length:137 Identity:38/137 - (27%)
Similarity:70/137 - (51%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFRECFYLFARSGQIN-NLDELTVIMRSLGLSPTIQELVSYL-----KQKNG-KMSFADFLDIMH 69
            ||:|.|.||.|:|:.. .|.::..::|:||.:||..|:...|     ::.|. |:.|..||.:|.
  Rat    72 EFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQ 136

  Fly    70 --QHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTV 132
              .::|.:...::.:...:..|.:..||:...:||::|...||.:...||:.:. ....::|..:
  Rat   137 AISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALL-AGQEDSNGCI 200

  Fly   133 RYADFVK 139
            .|..|||
  Rat   201 NYEAFVK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 38/137 (28%)
Myl1XP_008765516.1 PTZ00184 72..211 CDD:185504 38/137 (28%)

Return to query results.
Submit another query.