DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CABP5

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_016882481.1 Gene:CABP5 / 56344 HGNCID:13714 Length:284 Species:Homo sapiens


Alignment Length:145 Identity:49/145 - (33%)
Similarity:77/145 - (53%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLF--ARSGQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADFL 65
            :.:|:|.||.|..|  .|.|.|:..| |..:||::|..||..||:...:|    ..|::.|.||:
Human   138 QDEIEELREAFLEFDKDRDGFISCKD-LGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFV 201

  Fly    66 DIMHQHSKVESL----PDEVIAAFKAADPQNKGTISARQLRNLLQN-WGEGLSMREVDNIFREAN 125
            ::|......|:.    ..|:..|||..|....|.|:..:|:..:|. .||.|:.||:..:.|||:
Human   202 ELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREAD 266

  Fly   126 VNNNSTVRYADFVKI 140
            ||.:.||.:.:|||:
Human   267 VNGDGTVDFEEFVKM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 49/145 (34%)
CABP5XP_016882481.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.