DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and MYL1

DIOPT Version :10

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:144 Identity:39/144 - (27%)
Similarity:72/144 - (50%) Gaps:10/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FKEQDIDEFRECFYLFARSGQIN-NLDELTVIMRSLGLSPTIQELVSYLKQKNG------KMSFA 62
            |.::..|||:|.|.||.|:|... .|.::..::|:||.:||..|:...|...:.      |:.|.
Human    47 FSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFE 111

  Fly    63 DFLDIMH--QHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREAN 125
            .||.:|.  .::|.::..::.:...:..|.:..||:...:||::|...||.:...||:.:. ...
Human   112 QFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALM-AGQ 175

  Fly   126 VNNNSTVRYADFVK 139
            .::|..:.|..|||
Human   176 EDSNGCINYEAFVK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 39/144 (27%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 39/144 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.