DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Acam

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:79/138 - (57%) Gaps:7/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLFAR--SGQINNLDELTVIMRSLGLSPT---IQELVSYLK-QKNGKMSFADFL 65
            |:.|.||::.|..|.:  :|:|.. .||..:||:||.:||   :|:|::..: ..||:::|.:|.
  Fly     6 EEQIAEFKDAFVQFDKEGTGKIAT-RELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFC 69

  Fly    66 DIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNS 130
            .||.:..:.....:|:..|||..|....|.||..:||.::.|.||.::..|:|.:.|||:.:.:.
  Fly    70 GIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDG 134

  Fly   131 TVRYADFV 138
            .:.|.:||
  Fly   135 MINYEEFV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 45/138 (33%)
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 45/138 (33%)
EFh 11..73 CDD:238008 21/62 (34%)
EFh 84..146 CDD:238008 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.