DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and tnnc1

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001004776.1 Gene:tnnc1 / 447990 XenbaseID:XB-GENE-480515 Length:161 Species:Xenopus tropicalis


Alignment Length:143 Identity:40/143 - (27%)
Similarity:77/143 - (53%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLF---ARSGQINNLDELTVIMRSLGLSPT---IQELVSYLKQK-NGKMSFADF 64
            |:..:|||..|.:|   |..|.|:. .||..:||.||.:||   :||::..:.:. :|.:.|.:|
 Frog    14 EEQKNEFRAAFDIFVQDAEDGCIST-KELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEF 77

  Fly    65 LDIMHQHSKVES---LPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANV 126
            |.:|.:..|.:|   ..:|:...|:..|....|.|...:|:.:|:..||.::..:::.:.|:.:.
 Frog    78 LVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLEATGETITEDDIEELMRDGDK 142

  Fly   127 NNNSTVRYADFVK 139
            ||:..:.|.:|::
 Frog   143 NNDGRIDYDEFLE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 40/143 (28%)
tnnc1NP_001004776.1 PTZ00184 9..157 CDD:185504 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.