DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CG17770

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:139 Identity:43/139 - (30%)
Similarity:72/139 - (51%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLF----ARSGQINNLDELTVIMRSLGLSPTIQELVSYL-KQKNGKMSFADFLD 66
            |:.:.:....|.||    .:...|.||.:|.:.:........:||:.:.: ...:|::..:|||.
  Fly    22 EEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFLH 86

  Fly    67 IMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNST 131
            ||.|.....|..||:||||:..|.:..|.||..:.|:::||.||.|:..||:.|.|:||.:....
  Fly    87 IMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEGN 151

  Fly   132 VRYADFVKI 140
            :.|..||::
  Fly   152 IDYVRFVRM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 43/139 (31%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 43/139 (31%)
EFh 27..89 CDD:298682 14/61 (23%)
EFh 63..126 CDD:238008 21/62 (34%)
EFh 100..162 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.