DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and TpnC73F

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster


Alignment Length:113 Identity:26/113 - (23%)
Similarity:60/113 - (53%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IMRSLGL---SPTIQELVSYL-KQKNGKMSFADFLDIMHQ---HSKVESLPDEVIAAFKAADPQN 92
            |:|.:|.   ...::||:..: :.|:|::.|.:|:.:..:   ....|::..|:..||:..|.|.
  Fly    39 ILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQG 103

  Fly    93 KGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYADFVKI 140
            .|.|....|:.:|:...:.|:.:|:|.:..|.:.:.:.||.:.:|:::
  Fly   104 NGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 26/113 (23%)
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.