DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Calml5

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_344628.5 Gene:Calml5 / 364774 RGDID:1310047 Length:147 Species:Rattus norvegicus


Alignment Length:146 Identity:37/146 - (25%)
Similarity:77/146 - (52%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARS--GQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKM 59
            |:..|.::.:.|..:.|....::  |:| |:.||..:|:.:|.:...::|.:.:.:    .:|.:
  Rat     1 MSHGFTKEQVAELHQAFDRVDKNKDGRI-NVQELGDVMKQMGKNIPEKDLKALISRIDTDGDGTI 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            ||.:||..|.::.|  ...:|:.|.|:..|....|.|:..:|:..|...||.||..|::::.|.|
  Rat    65 SFEEFLTAMEKYKK--GSKEELQAVFRVFDQNGDGYITMDELKQGLSQMGETLSEEELNDMIRVA 127

  Fly   125 NVNNNSTVRYADFVKI 140
            :.:.:..|.|.:|:::
  Rat   128 DADQDGKVNYEEFLRV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 37/146 (25%)
Calml5XP_344628.5 PTZ00184 1..147 CDD:185504 37/146 (25%)
EFh 12..73 CDD:238008 15/61 (25%)
EFh 83..142 CDD:238008 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.