DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and TpnC41C

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:67/136 - (49%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RECFYLF--ARSGQINNLDELTVIMRSLGL---SPTIQELVSYLKQK-NGKMSFADFLDIMHQ-- 70
            |..|..|  .::|.||.. .:..|:..||.   ..|:.::::.:.:. :|::.|.:|..:..:  
  Fly    14 RNAFNAFDPEKNGYINTA-MVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFL 77

  Fly    71 -HSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTVRY 134
             ....|::..|:..||:..|.:..|.|:...||.:|:...:.|:..::|.:..|.:.:.:.||.:
  Fly    78 VEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTVDF 142

  Fly   135 ADFVKI 140
            .:|:::
  Fly   143 DEFMEV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 29/136 (21%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.