DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CG17493

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:134 Identity:38/134 - (28%)
Similarity:70/134 - (52%) Gaps:5/134 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFRECFYLFARSGQ-INNLDELTVIMRSLGLSPTIQELVSYL----KQKNGKMSFADFLDIMHQH 71
            :.:|.|.||...|. ...:.||.|.:|:||..|..:|:...:    |..:|:::|..||.:|...
  Fly    42 DIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVFLQLMTIK 106

  Fly    72 SKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYAD 136
            ...:...:|::.||:..|..:.|.||.|.|:.:.:..||.|:..|:..:..||:::|:..|...:
  Fly   107 MAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDNDGEVNQEE 171

  Fly   137 FVKI 140
            |::|
  Fly   172 FLRI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 38/134 (28%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 38/134 (28%)
EFh 42..104 CDD:238008 18/61 (30%)
EFh 115..177 CDD:238008 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.