DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CG31960

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:145 Identity:39/145 - (26%)
Similarity:74/145 - (51%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KEQDIDEFRECFYLFAR--SGQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADF 64
            :|||:  .:..:.|..:  .|.|.: .||.:::|:||..|...|:.|.:.:    .||.::..:|
  Fly     7 EEQDL--LKNIYSLLDKDNEGAITS-KELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68

  Fly    65 LDI----MHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREAN 125
            .::    ||..:|.|.|.|    ||:..|.:|.|.||..:||.:....||.|...|::.:.||.:
  Fly    69 CNVILRKMHDTNKEEELRD----AFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYD 129

  Fly   126 VNNNSTVRYADFVKI 140
            ::.::.:.:.:|..:
  Fly   130 LDQDNHINFEEFTNM 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 39/145 (27%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 39/145 (27%)
EFh 12..72 CDD:238008 14/60 (23%)
EFh 84..146 CDD:238008 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.